Protein Info for MPMX19_00936 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 51 to 68 (18 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 13 to 310 (298 residues), 100.5 bits, see alignment E=5.1e-33

Best Hits

KEGG orthology group: None (inferred from 83% identity to azl:AZL_016760)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>MPMX19_00936 hypothetical protein (Azospirillum sp. SherDot2)
MRKNMLPYHVVELRGLACILLVAYHVVGIPGSGMQVAEGSIYRYATDSFELIRMPLFTFI
SGLVYALNPARNDRLKTFFVKKLRRLGFPFLVVSAIFYFLQTHAPGANGSFVPESMWRIY
VYPYAHFWYLQALFLIFSVVALLDALHAMDRPGGFVLAMAAAVAACLTVHVESNIFSINE
ACFLLPHFLFGVGVTRFRAMVPRQTMQAAAGAALALGVALHQASLWGYLPHFGWNSSVAL
LCGMGGAVTLLHTMPSSRIFRTVGASSYAIYLHHALFAAGTRVVLHHVDAPDGVIFWGAL
LSGLIGPMVLEMLAQFRPWTRVALMGKA