Protein Info for MPMX19_00932 in Azospirillum sp. SherDot2

Annotation: 50S ribosomal protein L9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR00158: ribosomal protein bL9" amino acids 1 to 145 (145 residues), 131.3 bits, see alignment E=1.9e-42 PF01281: Ribosomal_L9_N" amino acids 1 to 46 (46 residues), 77 bits, see alignment E=6.1e-26 PF03948: Ribosomal_L9_C" amino acids 64 to 145 (82 residues), 88 bits, see alignment E=4.6e-29

Best Hits

Swiss-Prot: 66% identical to RL9_RHOCS: 50S ribosomal protein L9 (rplI) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K02939, large subunit ribosomal protein L9 (inferred from 96% identity to azl:AZL_016800)

Predicted SEED Role

"LSU ribosomal protein L9p" in subsystem CBSS-262719.3.peg.410 or Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>MPMX19_00932 50S ribosomal protein L9 (Azospirillum sp. SherDot2)
MEVILLERVEKLGQMGQVVNVRPGFARNYLLPQRKAMRATKANLAVFDKQKAHLEAVNLE
RRKDAEQVATKMDKVTVVVIRQAAETGVLYGSVTTRDVSDALTAAGYKTDRKQVQIDTPI
KTLGLFKLRVVLHPEVSITVTVNVARSAEEAELQAQRGGMITAADLRDDDDEEETFVEES
ATEEEEG