Protein Info for MPMX19_00843 in Azospirillum sp. SherDot2

Annotation: Ribonuclease 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR02191: ribonuclease III" amino acids 32 to 254 (223 residues), 220.2 bits, see alignment E=1.2e-69 PF14622: Ribonucleas_3_3" amino acids 41 to 175 (135 residues), 108 bits, see alignment E=6.1e-35 PF00636: Ribonuclease_3" amino acids 73 to 163 (91 residues), 77.9 bits, see alignment E=1.4e-25 PF00035: dsrm" amino acids 190 to 254 (65 residues), 60.3 bits, see alignment E=3.3e-20

Best Hits

Swiss-Prot: 45% identical to RNC_BRADU: Ribonuclease 3 (rnc) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 92% identity to azl:AZL_011820)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>MPMX19_00843 Ribonuclease 3 (Azospirillum sp. SherDot2)
MSTVTKAPADLGAGSDIQPDGAARSADVASLAQALGYEFSDPSLLHDAVTHPSLMGLERT
GRKGHKGPGIAYERLEFLGDRVVGLVVAQWLLERYPNEREGALAKRHAALVRRESLGRVA
DAIGLGAYLRLSPAEAQSGGRENRTILGDACEAVLGAMYLDGGLEPVTRFVRQALAGEID
KATPPPLDSKTTLQEWAQGRGKPLPRYELIERSGPAHEPLFVVAVHVEGMDPVSGSGSSK
RIAEKKAASALLRQVGVQVDD