Protein Info for MPMX19_00732 in Azospirillum sp. SherDot2

Annotation: Transcription antitermination protein NusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01951: transcription antitermination factor NusB
  • amino acids 40 to 177 (138 residues), 105.8 bits, E=9.8e-35
• PF01029: NusB
  • amino acids 42 to 176 (135 residues), 87.2 bits, E=6.4e-29

Best Hits

Swiss-Prot: 43% identical to NUSB_RHOPB: Transcription antitermination protein NusB (nusB) from Rhodopseudomonas palustris (strain BisB18)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 95% identity to azl:AZL_010140)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Protein Sequence (195 amino acids)

>MPMX19_00732 Transcription antitermination protein NusB (Azospirillum sp. SherDot2)
MSNDDAGSPVTPERASGEPKGGKSKSRKNKTGGGSAKARRKAARLAAAQALYQIDLAQAP
VENVVGEFVAHRLGEEIDGDKFVAGDPQLFADIVRGAIHRRAEVDGVLGAALDPRFPLDR
LELLLRAILRAGAYEIAVHTDTHPRILISEYVDVARAFFSGREPAMVNGVLDHVARALRA
DDLAKPDPGRNAAEE