Protein Info for MPMX19_00713 in Azospirillum sp. SherDot2

Annotation: Pyridoxine/pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 9 to 191 (183 residues), 233.4 bits, E=1.1e-73
• PF01243: Putative_PNPOx
  • amino acids 20 to 106 (87 residues), 93.4 bits, E=1.2e-30
• PF12766: Pyridox_oxase_2
  • amino acids 26 to 102 (77 residues), 33.1 bits, E=1.1e-11
• PF10590: PNP_phzG_C
  • amino acids 159 to 210 (52 residues), 57.4 bits, E=1.6e-19

Best Hits

Swiss-Prot: 68% identical to PDXH_RHORT: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 86% identity to azl:AZL_009950)

MetaCyc: 45% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (6/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (210 amino acids)

>MPMX19_00713 Pyridoxine/pyridoxamine 5'-phosphate oxidase (Azospirillum sp. SherDot2)
MTDNNDRNPRSPYDLFAEWMKEAEQSEPNDPNAMALATADANGIPSVRMVLLKGIDPRGF
VFYTNTESRKGTQLLANRNAALCFHWKSLRRQVRVEGPVEIVTDAEADAYFESRPRESRI
GAWASLQSRPLEGRWELEKRVAQFAARYAIGTVPRPPHWTGFRVLPSRIEFWRDRPFRLH
DRLVFQRAEGQGTEGTDADAPGWTTEHLFP