Protein Info for MPMX19_00689 in Azospirillum sp. SherDot2

Annotation: Glyceraldehyde-3-phosphate dehydrogenase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 3 to 109 (107 residues), 129.7 bits, E=4.7e-42
• TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I
  • amino acids 4 to 330 (327 residues), 437.2 bits, E=2e-135
• PF02800: Gp_dh_C
  • amino acids 163 to 319 (157 residues), 218.2 bits, E=4.7e-69

Best Hits

Swiss-Prot: 66% identical to G3P_RHOSH: Glyceraldehyde-3-phosphate dehydrogenase (gapB) from Rhodobacter sphaeroides

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 96% identity to azl:AZL_009710)

MetaCyc: 56% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.13) / NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12, EC 1.2.1.13)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• homolactic fermentation (12/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• heterolactic fermentation (15/18 steps found)
• ethene biosynthesis V (engineered) (20/25 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• gluconeogenesis III (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• glycolysis IV (8/10 steps found)
• oxygenic photosynthesis (13/17 steps found)
• gluconeogenesis I (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• glycerol degradation to butanol (10/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12, 1.2.1.13

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.13

Protein Sequence (340 amino acids)

>MPMX19_00689 Glyceraldehyde-3-phosphate dehydrogenase 1 (Azospirillum sp. SherDot2)
MAVRVAINGFGRIGRLVLRAIYESGRKDVEVVAINDLADLKANAHLLKYDSVHGRFPGTI
ETGADENGNGVLIVNGHSIKVVQERDPAKLPWKDLGVQIAMECSGIFTKRADAAKHLEAG
AEKVLISAPATDEDITVVYGVNHDKLTAEHRIVSNASCTTNCLAPVAFVLNNLVGIEKGF
MTTIHSYTGDQRIVDTNHKDLHRARAAALNMIPTSTGAAKAVGKVLPELKGKLDGTAMRV
PTPNVSVVDFKFTSKRATSVEEITKAISDAANGPLKGVLEAYTEELVSTDFNHDPHSSIF
ALNETKVIDGNFVRIMTWYDNEWGFSNRMSDTAVAMANAK