Protein Info for MPMX19_00673 in Azospirillum sp. SherDot2

Annotation: [Ribosomal protein S5]-alanine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 21 to 165 (145 residues), 79.5 bits, E=6.2e-26
• PF13420: Acetyltransf_4
  • amino acids 28 to 185 (158 residues), 27.2 bits, E=5.4e-10
• PF00583: Acetyltransf_1
  • amino acids 65 to 165 (101 residues), 33.9 bits, E=5e-12

Best Hits

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 94% identity to azl:AZL_009550)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128

Protein Sequence (196 amino acids)

>MPMX19_00673 [Ribosomal protein S5]-alanine N-acetyltransferase (Azospirillum sp. SherDot2)
MIRLLGSGLIGPPAIRLDGPRCYIRPPLPRDWREWADLRATSRGFLTPWEPTWPADALTR
TAFARRLRRQAQEWRDDLGYSFLIFDRGTDALVGGLGLTNIRRGVAQMGTLGYWAGQPYA
RNGYVSGGTRLALEFAFGQLGLHRVEAACLPTNLPSRGLLEKVGFSHEGYARGYLRIDGA
WRDHVLYAILREEWQA