Protein Info for MPMX19_00662 in Azospirillum sp. SherDot2

Annotation: Periplasmic nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 PF04879: Molybdop_Fe4S4" amino acids 5 to 58 (54 residues), 26.1 bits, see alignment 1e-09 PF00384: Molybdopterin" amino acids 62 to 473 (412 residues), 135.6 bits, see alignment E=3.4e-43 PF01568: Molydop_binding" amino acids 567 to 676 (110 residues), 65.9 bits, see alignment E=4.7e-22

Best Hits

KEGG orthology group: None (inferred from 95% identity to azl:AZL_009480)

Predicted SEED Role

"Anaerobic dehydrogenases, typically selenocysteine-containing" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (683 amino acids)

>MPMX19_00662 Periplasmic nitrate reductase (Azospirillum sp. SherDot2)
MSAQFLPTACPHDCPSTCALEVERLAPDRIGKVRGAAENSYTAGVICAKVSRYAERVHAP
DRLKTPLLRSGPKGSGQWREIGWDEALDRIADAFLTAERAHGPEAVWPYFYAGTMGLVQR
GGIQRLRHAKGYSRQTSTVCDTPANMGWLAGYGDIRGADPREMADSDLIVNWGGNPVATQ
VNVMTHVSRARKGRGAKLVTIDPYRTGTAEVSDLHLMLRPGTDGALACAVMHVLFRDGHA
DRAYLARLAGDTAALEAHLATRTPEWAASITGLTVAEIEEFARLYGTTKRSYLRVGYGLS
RAHNGAAQVHAVSCLPVVTGAWQHKGGGALYCSSGIYKLDKTLSEGLDRLDKSVRSFDQS
RIGAVLTGDPRDLTSGPPVTAMLIQNTNPVTICPDSNRVRQGFLREDLFVAVHEQFMTDT
ARLADLVIPATTFLEHDDIYRGGGQMHILIGRKVIEPQFEARENHWVISELARRVGAEHP
GFGMTALEIIDAMLKASDLGDAATLTADRWIDAQPDFETSHFLNGFAHPDAKFRFAPDWA
ALGPYGGMPELPDHMPPARDADAEHPFRLVTAPARQFLNTSFTETLTAQKREGRPTALIH
PEDAAGLALADGDAVRLGNPQGSVVVHAKSFAGVPRGVVIVEGIWPNSAFVEGMGINSLT
SPEPVPPAGGAAFHDTAVWMRAA