Protein Info for MPMX19_00655 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF00805: Pentapeptide" amino acids 60 to 97 (38 residues), 31.7 bits, see alignment 1.3e-11 amino acids 90 to 124 (35 residues), 38.5 bits, see alignment 1e-13 amino acids 171 to 209 (39 residues), 50.2 bits, see alignment 2.2e-17 amino acids 210 to 245 (36 residues), 29.4 bits, see alignment 6.9e-11 amino acids 284 to 321 (38 residues), 36.6 bits, see alignment 3.9e-13 amino acids 325 to 361 (37 residues), 46.5 bits, see alignment 3.2e-16 amino acids 380 to 417 (38 residues), 36.2 bits, see alignment 5.4e-13 amino acids 397 to 427 (31 residues), 28.3 bits, see alignment (E = 1.5e-10) PF13599: Pentapeptide_4" amino acids 67 to 127 (61 residues), 28.7 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to azl:AZL_009410)

Predicted SEED Role

"Pentapeptide repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>MPMX19_00655 hypothetical protein (Azospirillum sp. SherDot2)
MPTATTPTAQSVSFFRPDQLAEVLERHARWIKGQPGGARANLAMADLEGVDLSQRDLRGA
RLVGARLARGRLNGTNLAGADLFGVDLRDADISRANLMQTDLRGARLRAADFSNANLKGA
DLRAGTLEPGGTARRGTGPDAQDAESARQIHKAALARLQNGMTAEGGIPTDLTGAVLRGA
NLSDADLSGAMLQNADLSGAVLTGADLTGARLNGANLSGAALDGTRFDKADMVGTRMADC
DLSSTRIATAQMTRPIDSMGSEIQRAIFDHERWIDSFGQRGQRADLDGADLSRADLRNVN
LSAASLRGANLSAAALTGARLMMTDLSGANLEGANLMGADLSGANLSYAVLTGADLTRVR
LGPAAIKDPSGRPTGRSWAANLMGADMRGALLVGTCLVQANLSDANLDSADMDGADMAGA
KLQRATLPGRPPRRG