Protein Info for MPMX19_00620 in Azospirillum sp. SherDot2

Annotation: Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF00364: Biotin_lipoyl" amino acids 8 to 79 (72 residues), 49.4 bits, see alignment E=6.4e-17 PF00561: Abhydrolase_1" amino acids 134 to 358 (225 residues), 120.8 bits, see alignment E=1.6e-38 PF12146: Hydrolase_4" amino acids 134 to 357 (224 residues), 65.5 bits, see alignment E=9.3e-22 PF12697: Abhydrolase_6" amino acids 136 to 364 (229 residues), 99.2 bits, see alignment E=1.1e-31

Best Hits

Swiss-Prot: 53% identical to ACOC_CUPNH: Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (acoC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 93% identity to azl:AZL_009060)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex (EC 2.3.1.-)" in subsystem Acetoin, butanediol metabolism (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.12

Use Curated BLAST to search for 2.3.1.- or 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>MPMX19_00620 Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (Azospirillum sp. SherDot2)
MLNERIKPIVMPKWGLSMSEGKVTGWLKQPGSTISIGDELLEVETDKITNVVEAGETGVL
RRVLGEAGTVYPVKALIAVLAEPDVPDDDIDAFISAYAVPASEDDGEAEAGPQYHIAETP
AGTIRYAKRGEAGPTVLLVHGFGGDLDNWLFTIDALAEKATVYALDLPGHGQSNKQIADP
SLSGLSKAVLGFLDAVGVERAHFVGHSMGGAVSMRTALDAPGRVASLSLIASAGLGEQID
HGYIQGFVGATSRRDLKPVLETLFADRGLVSRQMVDDLLKYKRLDGVDEALRALSASLFA
EGRQASVLAAGIADARTPTLVVWGEEDRVIPADHAQALANTAQVAVLPGAGHMVQMEAAG
KVNALLKDHIAKAD