Protein Info for MPMX19_00541 in Azospirillum sp. SherDot2

Annotation: Tungstate uptake system permease protein TupB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 24 (6 residues), see Phobius details amino acids 33 to 55 (23 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details

Best Hits

Swiss-Prot: 41% identical to ANTRP_HALVD: Probable anion ABC transporter permease protein HVO_1887 (HVO_1887) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K05773, putative tungstate transport system permease protein (inferred from 90% identity to azl:AZL_007250)

Predicted SEED Role

"ABC-type tungstate transport system, permease protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>MPMX19_00541 Tungstate uptake system permease protein TupB (Azospirillum sp. SherDot2)
MQDFSQALAVAFSMILSMDDALMRIVGLSLRVSLSAVAIATLIGLPLGAAVAALSFPGRR
AVAVALNTMMGLPPVVVGLVVYLLLSRSGPFGVLGLLFTPTAMIVAQTVMIVPIVASLAR
QTVEDLLAEYDDLLRVTGAGPVRRLATLLAEARWSLVTTVLAGFGRASAEVGAVMIVGGN
IEHVTRVMTTAIALETSKGDLPMALGLGLVLMTLSLAVNLTASLLKETAARPA