Protein Info for MPMX19_00492 in Azospirillum sp. SherDot2

Annotation: Cobalamin biosynthesis protein CbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details PF03186: CobD_Cbib" amino acids 15 to 305 (291 residues), 191.8 bits, see alignment E=8.2e-61

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_006760)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.10

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>MPMX19_00492 Cobalamin biosynthesis protein CbiB (Azospirillum sp. SherDot2)
MFGSAFGGPGPLLLLLLALGIDALFGDWLDRILPDPAGLARRFCNAADARLNRAERGKSA
QMFRGALVVLALVLIAAAAGLLVEWIGSIGRGWMVELLALLCGLRGRAAWTRVRAVRRAL
ESGGVVAGQEAIQSLTRRHVYGLDEHGIARAAVEAAARAFDRKLVAPVFGYALLGVPGLF
VWTAMDGADAALGSPGVRHGRFGSTAATLDDALNALPARLAGLLLALAAPFIGTAKAGGA
LRALGRDARKHPSLNMGWPIAAMAGALGLALGGPHRDGGVVITENWIGDGRARVTPADIG
RALALSAVASLLLVGLVALLLWGVAGI