Protein Info for MPMX19_00485 in Azospirillum sp. SherDot2

Annotation: L-arabinose transport system permease protein AraQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 277 (184 residues), 73.4 bits, see alignment E=9.9e-25

Best Hits

Swiss-Prot: 60% identical to UGPE_RHIME: sn-glycerol-3-phosphate transport system permease protein UgpE (ugpE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 94% identity to azl:AZL_006700)

MetaCyc: 54% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>MPMX19_00485 L-arabinose transport system permease protein AraQ (Azospirillum sp. SherDot2)
MKPTRFIDLLPHIVLIVGVLIFAYPIYVTLIGSTWDSGTIGRGGLPLWPGGQGVTNYAQA
WVGEAGDRAMYTPVRTMMLNSLVMALSIALGKIAISILSAYAVAFFRFPLRMAFFWLIFI
TLMLPVEVRIIPTYKVVADLGLINTYAGLAIPLIASATATLLFRQFFLTIPDELLEAAKI
DGAGPVRFFIDVVLPLSRTNIAALFVILFIYGWNQYLWPLLVTSSGDMETIVTGITKMIG
TGESANDWHIIMATTVLAMLPPVAVVVFMQRWFVKGLVDSEK