Protein Info for MPMX19_00323 in Azospirillum sp. SherDot2

Annotation: 30S ribosomal protein S16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR00002: ribosomal protein bS16" amino acids 3 to 82 (80 residues), 107.7 bits, see alignment E=1.2e-35 PF00886: Ribosomal_S16" amino acids 9 to 70 (62 residues), 102.5 bits, see alignment E=4.7e-34

Best Hits

Swiss-Prot: 73% identical to RS16_GLUOX: 30S ribosomal protein S16 (rpsP) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K02959, small subunit ribosomal protein S16 (inferred from 97% identity to azl:AZL_005160)

Predicted SEED Role

"SSU ribosomal protein S16p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>MPMX19_00323 30S ribosomal protein S16 (Azospirillum sp. SherDot2)
MALKIRLARGGAKKRPFYSIVIADARSPRDGRFIEKIGTYNPMLPREHEQRIILNAERAK
HWLSVGAQPTDRVVHFLANAGLVEKPAVRETPKKSAPKAKAQERLKAEAAAAAAAAEG