Protein Info for MPMX19_00253 in Azospirillum sp. SherDot2

Annotation: FtsZ-localized protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 3 to 72 (70 residues), 33.8 bits, E=8.5e-12
• PF13417: GST_N_3
  • amino acids 4 to 78 (75 residues), 47.1 bits, E=6.2e-16
• PF13409: GST_N_2
  • amino acids 13 to 73 (61 residues), 55 bits, E=2.6e-18
• PF00043: GST_C
  • amino acids 147 to 198 (52 residues), 26.7 bits, E=1.4e-09
• PF14497: GST_C_3
  • amino acids 148 to 205 (58 residues), 21.7 bits, E=4.8e-08

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 98% identity to azl:AZL_003830)

Predicted SEED Role

"Glutathione S-transferase family protein" in subsystem Glutathione: Non-redox reactions

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (4/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (222 amino acids)

>MPMX19_00253 FtsZ-localized protein A (Azospirillum sp. SherDot2)
MRTLYHHPIHALSRTARVMLAEKGLPFEPVVERPWERRTDFLKLNPAAEVPVLVEEDGTV
VAGGLAVIEYLEEAYPDTPLLPREIAARAEVRRVADWFLHKFEREVAENLVGEKLIKRLS
GQGHPFAPAIRAGLANVTYHLDYIAFLSERRPWLAGSSFTLADIAAAVQLSCLDYIDNVP
WDRSPEAKDWYARIKSRPSFRALLADNITGCPPPKHYADLDF