Protein Info for MPMX19_00230 in Azospirillum sp. SherDot2

Annotation: putative D,D-dipeptide transport system permease protein DdpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 44 to 68 (25 residues), see Phobius details amino acids 107 to 134 (28 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details PF12911: OppC_N" amino acids 36 to 82 (47 residues), 57.2 bits, see alignment 1.2e-19 PF00528: BPD_transp_1" amino acids 123 to 304 (182 residues), 105.4 bits, see alignment E=3.1e-34

Best Hits

Swiss-Prot: 47% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 90% identity to azl:AZL_003610)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MPMX19_00230 putative D,D-dipeptide transport system permease protein DdpC (Azospirillum sp. SherDot2)
MTARTDTQSAGWRDWLTTDTPQSRAQARLGRAWAGWTAFRRNRLAVAGLLIVLALVVVAA
LAPVLAPYHPYAQDLNNRLLPPSAAHWLGTDAFGRDILSRLIHGARLTLMIVALVAATAP
LAGLVIGTAAGYFGGWVDTVLMRITDIALAFPKLILALAFVAALGPGIENAVIAIAITSW
PPYARIARAETLTVRRADFISAARLQGASSLRIILGHIMPLCIASLIVRTTLDMAGVILT
AAGLGFLGLGAQPPLPEWGAMIASGRQYVLEQWWVAAMPGLAIFIVSLGFNLLGDGLRDV
LDPKGD