Protein Info for MIT1002_04204 in Alteromonas macleodii MIT1002

Annotation: putative chromate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 172 to 202 (31 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details amino acids 390 to 414 (25 residues), see Phobius details amino acids 426 to 454 (29 residues), see Phobius details amino acids 461 to 482 (22 residues), see Phobius details PF02417: Chromate_transp" amino acids 40 to 202 (163 residues), 146.2 bits, see alignment E=4.6e-47 amino acids 277 to 473 (197 residues), 124.5 bits, see alignment E=2.2e-40 TIGR00937: chromate efflux transporter" amino acids 44 to 434 (391 residues), 215.8 bits, see alignment E=7e-68

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 86% identity to maq:Maqu_3191)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>MIT1002_04204 putative chromate transport protein (Alteromonas macleodii MIT1002)
MHEPSTSSVPPSSGSNQITRDATAGNLNAFGHHITFGEAVRVWLRVAILSFGGPAGQIAV
MHRILVDEKQWVSESRFLHALNYCMVLPGPEAQQLATYIGWLLHGIKGGLVAGALFVLPG
FLSILVLSLLYAGFQEASLVQALFFGIKAAVLAIVIQAVIRIGKRVLKNAYMYALAVAAF
VAIFFFAVPFPIVIVTAGLIGLLGRHVDPERFVVIKGHDTPEDAGRAIDAMMEGGAASHT
RASRGRALKVLAVWLPLWFAPLVALLVTLGYEDVFTQIGLFFSKLAVVTFGGAYSVLAYM
AQEAVQNYGWLAPGEMLDGLGMAETTPGPLIQVVQFVGFMGAFRAPGTLDPFTAGILASV
LATWVTFVPCFLWIFLGAPYVETLRGNQAVSAALSAVTAAVVGVMLNLAIWFAVHVAFNE
VETVRAYGMLLLIPAWGSIHIVSVALAAGAFIAMLRFKVGMLPMILVSALLGIVYHLLFA
GVPAA