Protein Info for MIT1002_04124 in Alteromonas macleodii MIT1002

Annotation: Glucose-inhibited division protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 transmembrane" amino acids 601 to 619 (19 residues), see Phobius details TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 7 to 622 (616 residues), 941.8 bits, see alignment E=7.8e-288 PF12831: FAD_oxidored" amino acids 8 to 149 (142 residues), 37.3 bits, see alignment E=5.2e-13 PF01134: GIDA" amino acids 8 to 399 (392 residues), 579.9 bits, see alignment E=7.1e-178 PF00890: FAD_binding_2" amino acids 8 to 38 (31 residues), 20.4 bits, see alignment (E = 6.5e-08) PF21680: GIDA_C_1st" amino acids 460 to 555 (96 residues), 87 bits, see alignment E=3e-28 PF13932: SAM_GIDA_C" amino acids 558 to 626 (69 residues), 85.4 bits, see alignment E=5.8e-28

Best Hits

Swiss-Prot: 97% identical to MNMG_ALTMD: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 97% identity to amc:MADE_04094)

MetaCyc: 72% identical to 5-carboxymethylaminomethyluridine-tRNA synthase subunit MnmG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>MIT1002_04124 Glucose-inhibited division protein A (Alteromonas macleodii MIT1002)
MFYAEAFDVIVVGGGHAGTEAALAAARMGANTLLLTHNIETIGQMSCNPAIGGIGKGHLV
KEIDALGGAMALAIDKGGIQFRTLNSSKGPAVRATRAQADRTLYKNAIRDIVENQENLTL
FQQSVDDLIVENDQVCGVVTQMGLKFKAKSVVLTVGTFLGGTIHIGLENYRGGRAGDPPS
IALADRLRALPFRVDRLKTGTPARLDARSLDFSVMQPQPGDNPTPVFSFMGDRTMHPTQI
PCYITHTNEKTHDIIRGGLDRSPMFTGVIEGIGPRYCPSIEDKITRFADKTSHQIFVEPE
GLNSIEVYPNGISTSLPFDVQMNLVRSIKGFENAHIVRPGYAIEYDFFDPRDLKQTLETK
FIRGLFFAGQINGTTGYEEAGAQGLVAGANAALQVQEKDPMILRRDQAYMGVLIDDLATM
GTKEPYRMFTSRAEYRLLLREDNADSRLTAMGREIGLVDDARWAKFNDKMEAVESELQRL
RGQWIHPDHAATPELNTMLKNPVSREHSLEELIRRPEMTYGQLMEIESVGPGLEDPVAAE
QVEIQIKYAGYIARQMDEIAKTQRHENTLLPVDMDFRKISGLSNEVVAKLTEARPETIGK
ASRISGITPAAISLLLVYLKKHGMLRKQEKISA