Protein Info for MIT1002_04121 in Alteromonas macleodii MIT1002

Annotation: putative chromosome-partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 37 to 210 (174 residues), 200.1 bits, see alignment E=1.4e-63 PF02195: ParBc" amino acids 41 to 130 (90 residues), 111.1 bits, see alignment E=3.7e-36 PF17762: HTH_ParB" amino acids 181 to 230 (50 residues), 56.4 bits, see alignment 3.2e-19 PF23552: ParB_dimer" amino acids 244 to 292 (49 residues), 77.1 bits, see alignment 8.3e-26

Best Hits

Swiss-Prot: 61% identical to PARB_VIBCH: Probable chromosome-partitioning protein ParB (parB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 99% identity to amc:MADE_04091)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>MIT1002_04121 putative chromosome-partitioning protein ParB (Alteromonas macleodii MIT1002)
MSARKRGLGRGLDALLATSQSSAQKEQDAAEVNSTNGELSKLPIEYLVPGKYQPRKDMSP
EALEELASSIRAQGIIQPIVVRKVDEHRYEIIAGERRWRASQLAQLDEVPCLVKNVPDEA
AVAIALIENIQREDLNAMEEAQALDRLMNEFALTHQEVAEAVGKSRTTVTNLLRLNNLND
DVKLLVEHGDIEMGHARALLALEGDTQSETAQVVSGKGLTVRDTEKLVKKLLEPAKPKPE
KKVDPDVQNLMTRLSENLGTPVSIDHNAKGKGKLTISFSDLEQLDGIISKIQ