Protein Info for MIT1002_04120 in Alteromonas macleodii MIT1002

Annotation: F0F1 ATP synthase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details PF03899: ATP-synt_I" amino acids 17 to 109 (93 residues), 48.1 bits, see alignment E=6.6e-17

Best Hits

Swiss-Prot: 37% identical to ATPZ_VIBCH: ATP synthase protein I (atpI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02116, ATP synthase protein I (inferred from 85% identity to amc:MADE_04090)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>MIT1002_04120 F0F1 ATP synthase subunit I (Alteromonas macleodii MIT1002)
MTNKLAKRGLDLAKKGLLFQAVTALVVTAFAGAAGGSHSAMSAAAGALISILPNSVFMAF
AFRYAGASKNDLVARSFSQGSKLKLALTIILFVIAFKGLNAAPLEIFMAFVITTASHGLA
MFHYGTKE