Protein Info for MIT1002_04119 in Alteromonas macleodii MIT1002

Annotation: F-ATPase subunit 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 247 to 272 (26 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 41 to 271 (231 residues), 137.9 bits, see alignment E=2.5e-44 PF00119: ATP-synt_A" amino acids 47 to 271 (225 residues), 178.5 bits, see alignment E=8.7e-57

Best Hits

Swiss-Prot: 100% identical to ATP6_ALTMD: ATP synthase subunit a (atpB) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 100% identity to amc:MADE_04089)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>MIT1002_04119 F-ATPase subunit 6 (Alteromonas macleodii MIT1002)
MASEYTTSEYIKHHLTNATMCSTDNGIAFNKACSDAGFWAWHVDTLAWSIGLGLLFLIIF
RSVASKATTGVPGKMQAFVELVVEFVDDNVKSTFHGKSALIAPLALTIFVWVLLMNLMDL
VPVDLIPWVSGLIGQAAFGMDPHDVYNKAVPTTDLNLTFALASGVFILILFYSIKMKGIG
GFAKELTMQPFGHPIFIPVNFILETVTLLARPLSLALRLFGNLYASELIFILIATIGYFQ
LPLHFMWAVFHILVLPLQAFIFMMLTIVYLSLACEDH