Protein Info for MIT1002_04115 in Alteromonas macleodii MIT1002

Annotation: ATP synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 TIGR00962: ATP synthase F1, alpha subunit" amino acids 2 to 512 (511 residues), 840.6 bits, see alignment E=2.1e-257 PF02874: ATP-synt_ab_N" amino acids 28 to 92 (65 residues), 48.9 bits, see alignment E=1.1e-16 PF00006: ATP-synt_ab" amino acids 149 to 375 (227 residues), 263.1 bits, see alignment E=2.8e-82 PF00306: ATP-synt_ab_C" amino acids 382 to 507 (126 residues), 152 bits, see alignment E=1.6e-48

Best Hits

Swiss-Prot: 99% identical to ATPA_ALTMD: ATP synthase subunit alpha (atpA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02111, F-type H+-transporting ATPase subunit alpha [EC: 3.6.3.14] (inferred from 99% identity to amc:MADE_04085)

MetaCyc: 81% identical to ATP synthase F1 complex subunit alpha (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase alpha chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>MIT1002_04115 ATP synthase subunit alpha (Alteromonas macleodii MIT1002)
MQLNSTEIAELIKKRIEQFNVSSEARNEGTIVAVTDGIIRIHGLADVMQGEMIELPGSRY
AIALNLERDSVGAVVMGPYADLKEGDKVQSTGRILEVPVGNALLGRVVNTLGEPIDGKGA
IDAAGFEPVEKIAPGVIERQSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQCGKTAMAV
DAIINQKGTGIKCVYVAVGQKASTIANVVRKLEEHGALDHTIVVAASASESAALQYLAPY
SGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER
AARVNEQYVERYTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF
NAGIRPAVNAGISVSRVGGAAQTKIIKKLGGGIRLALAQYRELAAFSQFASDLDDATREQ
LEHGERVTELMKQKQYAPLSIADMGVSLFAVEKGFLKGIELNKILDFEAALHSYMNSEHA
DLMKTINESGNYNDEIASKLNDALTNFKATQTW