Protein Info for MIT1002_04036 in Alteromonas macleodii MIT1002

Annotation: LexA repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF01726: LexA_DNA_bind" amino acids 1 to 65 (65 residues), 99.6 bits, see alignment E=6.6e-33 TIGR00498: repressor LexA" amino acids 1 to 205 (205 residues), 259.1 bits, see alignment E=1.3e-81 PF00717: Peptidase_S24" amino acids 83 to 199 (117 residues), 114.9 bits, see alignment E=1.7e-37

Best Hits

Swiss-Prot: 96% identical to LEXA_ALTMD: LexA repressor (lexA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 96% identity to amc:MADE_04014)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>MIT1002_04036 LexA repressor (Alteromonas macleodii MIT1002)
MRPLTARQTEVLELIKTTMLETGMPPTRAEIARQLGFRSANAAEEHLKALARKGVIEILP
GTSRGIKLNIPLDNDAQEEEGLPLIGRVAAGEPILAQEHVESHYKVDPALFQPHADFLLR
VNGMSMKDIGILDGDLLAVHRTTDVHNGQVVVARVDEDVTVKRLEKRGREVLLHAENDEF
APIKVDLATEHFAIEGIAVGVIRNADWM