Protein Info for MIT1002_04028 in Alteromonas macleodii MIT1002

Annotation: Cytochrome oxidase assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 296 to 322 (27 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 3 to 337 (335 residues), 269.2 bits, see alignment E=2.2e-84

Best Hits

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>MIT1002_04028 Cytochrome oxidase assembly protein (Alteromonas macleodii MIT1002)
MKKLTLFSIFLAAVVIILGAYTRLTDAGLGCPDWPGCYGNLTVPLSEEKVAQANAAFPER
PVEAFKAWNEMIHRYFAGTLGLCVLAIAIIAIRQRDKGTPVKLPLLLLGLIIFQAALGMW
TVTLNLLPVVVMGHLLGGFSVLSCLFILYLRLRNTAGDASKIKQAPIASAMHEQGITDLP
QAKVFQRNLKLFAFIGLGVLVTQIALGGWTSANYAALACTEMPVCESGWQERIDLAGAFS
VPDADNYEFGAHDYGERVTMHIVHRFGAVITFLYLLALGISVLVSRYTTSKQKYVGAFML
VALCTQVALGLSNIIFMLPLAIAVMHNAVAAVLLLSLLNLIFTVFLALENDNVFGTEKRN
TGSFSGSKPLQGAGAFSIHEAPLHDPLNASTSSHILPKAPGGFHG