Protein Info for MIT1002_04020 in Alteromonas macleodii MIT1002

Annotation: Aspartate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR00035: aspartate racemase" amino acids 5 to 233 (229 residues), 232.4 bits, see alignment E=2.8e-73 PF01177: Asp_Glu_race" amino acids 10 to 227 (218 residues), 156.6 bits, see alignment E=4.3e-50

Best Hits

Swiss-Prot: 53% identical to YGEA_ECOBD: L-aspartate/glutamate-specific racemase (ygeA) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K01779, aspartate racemase [EC: 5.1.1.13] (inferred from 80% identity to amc:MADE_03998)

MetaCyc: 52% identical to amino acid racemase YgeA (Escherichia coli K-12 substr. MG1655)
5.1.1.-

Predicted SEED Role

"Aspartate racemase (EC 5.1.1.13)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 5.1.1.13)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>MIT1002_04020 Aspartate racemase (Alteromonas macleodii MIT1002)
MNTTKKLGLLGGMSWESTVSYYQAINRGVNARLGGLHSAPLIISSVDFAHIEQLQHKGEW
DKTADILIREAKHLETAGAKAILICTNTMHKVATDIEQKITIPLIHIADATGCVLQQDRV
KKVGLLGTRFTMEQTFYTSRLKEIFGIDVVTPNAQHRDTVHNIIYEQLCKGVICVESRNA
YIDIINELAAEGAEGIILGCTEIALLVQQHHTKVKLYDTTAIHASAAVDFALAP