Protein Info for MIT1002_04019 in Alteromonas macleodii MIT1002

Annotation: Fe/S biogenesis protein NfuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03341: IscR-regulated protein YhgI
  • amino acids 2 to 192 (191 residues), 328 bits, E=8.7e-103
• PF01521: Fe-S_biosyn
  • amino acids 2 to 98 (97 residues), 47.7 bits, E=1.7e-16
• PF01106: NifU
  • amino acids 111 to 173 (63 residues), 62.5 bits, E=3.3e-21

Best Hits

Swiss-Prot: 96% identical to NFUA_ALTMD: Fe/S biogenesis protein NfuA (nfuA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K07400, Fe/S biogenesis protein NfuA (inferred from 96% identity to amc:MADE_03996)

MetaCyc: 77% identical to iron-sulfur cluster carrier protein NfuA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NfuA Fe-S protein maturation"

Protein Sequence (192 amino acids)

>MIT1002_04019 Fe/S biogenesis protein NfuA (Alteromonas macleodii MIT1002)
MITISEEAQAHFVKLLSKQESGTNIRVFVVNPGTSSAECGVSYCPPDAVEETDTRLPFNG
FDAVVDEESAPYLEEAEIDYVTDQMGSQLTLKAPNAKARKVSDDAPLIERINYMIESEIN
PQLASHGGNVVLTELTDDGYAILQFGGGCNGCSMVDVTLKEGIEKQMVEQFAGELKGVRD
ATEHQAGEHSYY