Protein Info for MIT1002_03980 in Alteromonas macleodii MIT1002

Annotation: General secretion pathway protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF07963: N_methyl" amino acids 10 to 31 (22 residues), 23.5 bits, see alignment (E = 1.5e-09) TIGR01708: type II secretion system protein H" amino acids 11 to 179 (169 residues), 56.1 bits, see alignment E=3.9e-19 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 12 to 33 (22 residues), 23.4 bits, see alignment (E = 4e-09)

Best Hits

KEGG orthology group: K02457, general secretion pathway protein H (inferred from 94% identity to amc:MADE_03960)

Predicted SEED Role

"General secretion pathway protein H"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>MIT1002_03980 General secretion pathway protein H (Alteromonas macleodii MIT1002)
MRNRGSTSLNKAGFTLLEVMLVLLLMGLAAGYVMFNAFGASKSDLLKTQAQRLQVIVDMA
SDFAVLNQQQLGVRFEADKNEYYFVYLDDDDEWQRIEGEKTYEPYTLPEPFTFTLNLDDL
PWDVEDRLFDRELFDENLSVSDEGVEIGNEEEKKLPPPQVLIMSSGEITPFTLSFNYEGD
DGDAPVYYSLQNQDLPPLVLEGPLERPL