Protein Info for MIT1002_03978 in Alteromonas macleodii MIT1002

Annotation: General secretion pathway protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 172 to 195 (24 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 406 (403 residues), 533.6 bits, see alignment E=1.9e-164 PF00482: T2SSF" amino acids 74 to 196 (123 residues), 115.2 bits, see alignment E=9.9e-38 amino acids 276 to 398 (123 residues), 90 bits, see alignment E=6e-30

Best Hits

Swiss-Prot: 58% identical to GSPF_VIBCH: Type II secretion system protein F (epsF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 98% identity to amc:MADE_03958)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>MIT1002_03978 General secretion pathway protein F (Alteromonas macleodii MIT1002)
MAAFAFKAVNARGKNTNGVLEGDNARQVRQQLREKGLIPLEVEQVAERAQSEGKGLSFSL
FKPRISASDLALLTRQLATLVESALPVEEALLAVAEQCEKNRQKNMMMAVRSKVVEGHGL
ADALGQFPSVFDELYRAMVAAGEKSGHLDTVLNRLADYTERRQQTRSQITQAMIYPSLML
FFAMGIVLLLLTVVVPKIVGQFDHMGQDLPAITQFLISVSTWLQNYGLFMLIGIAVLVVI
IQRVLQQKHMKLRYHRALLTLPLIGRVSRGLNTARFARTLSILSASAVPLLEAMRISGDV
LENQHIKNQVADAAINVKEGSSLRAALDNTKMFPPMMMHMIASGEKSGELQQMLARAADN
QDREFEALIGVSLKVFEPLLIVSMAGIVLFIVMAILQPILALNNMVNI