Protein Info for MIT1002_03977 in Alteromonas macleodii MIT1002

Annotation: Type II traffic warden ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02533: type II secretion system protein E
  • amino acids 36 to 518 (483 residues), 731.8 bits, E=1.8e-224
• PF00437: T2SSE
  • amino acids 147 to 413 (267 residues), 376.3 bits, E=3.7e-117

Best Hits

Swiss-Prot: 76% identical to GSPE_AERHY: Type II secretion system protein E (exeE) from Aeromonas hydrophila

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 97% identity to amc:MADE_03957)

Predicted SEED Role

"General secretion pathway protein E"

Protein Sequence (521 amino acids)

>MIT1002_03977 Type II traffic warden ATPase (Alteromonas macleodii MIT1002)
MAGQDEQITQALEAQEEALEAMGEDAGLPEEEAGPRQLSFSFAKRNQVLLETNETPAVLY
FTENTPFDVFAEVRRFYGEPFVPKTIPANEFESLLTSAFQRDSSAAKQLMEDLGNESDLF
ALAEDLPDTEDLLDSEDDAPIIKLINAMLGEAIKEGASDIHIETFENQLVVRFRVDGVLR
EILRPNRKLSSMLVSRIKVMAKLDIAEKRVPQDGRITLRIAGRAVDVRVSTMPSSHGERV
VLRLLDKNNARLNLEDLGMTLQNRNHFSSLIRKPHGIILVTGPTGSGKSTTLYAGLTEIN
SRDRNILTVEDPIEFDLPGIGQTQVNPRVDMTFARGLRAILRQDPDVVMVGEIRDIETAQ
IAVQASLTGHLVLSTLHTNTAAGAITRLEDMGIEPFLLSSSLLAVLSQRLVRTLCPDCKK
PHSPDASELEILGQNATSDATIYKPHGCAACNQTGYRGRTGIHELLLVDEKVREMMHEGV
GEQAIERYIRKTTPSIREDGCSKVLAGATSLEEVLRVTRED