Protein Info for MIT1002_03976 in Alteromonas macleodii MIT1002

Annotation: Pullulanase secretion envelope PulD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 34 to 623 (590 residues), 534.8 bits, see alignment E=1.4e-164 PF21305: type_II_gspD_N0" amino acids 34 to 103 (70 residues), 89.5 bits, see alignment E=1.5e-29 PF03958: Secretin_N" amino acids 129 to 191 (63 residues), 48 bits, see alignment E=1.7e-16 amino acids 194 to 262 (69 residues), 54.5 bits, see alignment E=1.7e-18 amino acids 269 to 349 (81 residues), 55.9 bits, see alignment E=6.3e-19 PF00263: Secretin" amino acids 453 to 614 (162 residues), 177 bits, see alignment E=3.9e-56

Best Hits

Swiss-Prot: 53% identical to GSPD2_ECOH1: Secretin GspD 2 (gspD2) from Escherichia coli O78:H11 (strain H10407 / ETEC)

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 94% identity to amc:MADE_03956)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (683 amino acids)

>MIT1002_03976 Pullulanase secretion envelope PulD (Alteromonas macleodii MIT1002)
MKRRTSQKLLSRLSTAMCTALLCFSVTAAEYMPNFKDTDINEFINIVGKNLERTIIVDPN
VRGKISVRSYDMLDEDQYYQFFLNVLQVYDFAVVEMPSGILKVVRSKDAKTSNIPVVEGA
NRDGDEMITRVVPVYNVPVRELAPILRQLNDQAGGGNVVSHDPSNVMMLTGRAAVVNRLV
EIIERVDRAGDEEVEIVKLRYASASEMVRIIDSINKSQGKANTGTKSEPRVVADDRTNSV
IVSGDIKARQRLINLIQRMDQELESNGNTRVLFLNYAKAEDLVKVLQGVSASIQAEEQGS
GTTSRRASSNREISIDAHEDSNAIVITAEPDMMRSLEEVVRQLDIRRAQVQVEAIIVEVF
EGDGTTLGVQWVSEQGGGTQFNNGVVPVGSLAVALKQAEEDTNTETYVSDDGSPYTVTNT
REGDYTALASLLGGANGLIAGVIENGWGAVVQAVSTDTNSNILATPHLTTMDNEEAFFIV
GQEVPIITGTTTGSNNSNPFQTVDRQEVGIKLKVTPQINEGDAVQLLIEQEVSSVSGATS
VDISINKREIKTTVIVDDGGTIVLGGLIDEDVQESESKVPLLGDIPILGHLFKSTSTSKR
KRNLMVFLKPTIVRDGATMNAISHRKYNYIRALQLKRQQEGVSLMPYEETPTIPQWDDAL
ALPPSFEEYLSEKEKQKQEEGND