Protein Info for MIT1002_03964 in Alteromonas macleodii MIT1002

Annotation: MlotiK1 channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details PF00520: Ion_trans" amino acids 27 to 253 (227 residues), 131.4 bits, see alignment E=3.2e-42 PF07885: Ion_trans_2" amino acids 171 to 246 (76 residues), 54.1 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 90% identity to amc:MADE_03944)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>MIT1002_03964 MlotiK1 channel (Alteromonas macleodii MIT1002)
MAMSFQNACYHILAPASEAHEYKKLSKIFDVFLIALIIVNVVAMMLETVPGIPAIWQYEL
HIIEVVSVLIFTVEYFLRLYGSASAPNRPNHERTTTWQKRWSYLKSPMALVDLMAILPFY
LSVFVAFDLRILRIFRVMRILKIGRYSRSMQTLITVLRNESHSLIAALSVLLLFTIIAAT
CIYYIEHAAQPDVFSSIPASLWWALVTLTTVGYGDAVPITALGKIFGGLITIMGICFYAL
PAGILSSSYTSQMQLKRNRFKDTVRSVLDDGKLSEHDVHHLEHVRALLDLDEEEAKLIVR
LLQHHHKRLDD