Protein Info for MIT1002_03943 in Alteromonas macleodii MIT1002

Annotation: Biotin carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit" amino acids 1 to 444 (444 residues), 785 bits, see alignment E=1.1e-240 PF00289: Biotin_carb_N" amino acids 1 to 110 (110 residues), 153.3 bits, see alignment E=9.3e-49 PF02655: ATP-grasp_3" amino acids 114 to 294 (181 residues), 31.3 bits, see alignment E=6.4e-11 PF02786: CPSase_L_D2" amino acids 115 to 322 (208 residues), 282.7 bits, see alignment E=5e-88 PF02222: ATP-grasp" amino acids 142 to 292 (151 residues), 38.3 bits, see alignment E=3.5e-13 PF07478: Dala_Dala_lig_C" amino acids 143 to 291 (149 residues), 42.3 bits, see alignment E=1.9e-14 PF02785: Biotin_carb_C" amino acids 336 to 441 (106 residues), 126.5 bits, see alignment E=1.5e-40

Best Hits

Swiss-Prot: 80% identical to ACCC_ECOLI: Biotin carboxylase (accC) from Escherichia coli (strain K12)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 98% identity to amc:MADE_03926)

MetaCyc: 80% identical to biotin carboxylase (Escherichia coli K-12 substr. MG1655)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>MIT1002_03943 Biotin carboxylase (Alteromonas macleodii MIT1002)
MLDKVLIANRGEIALRILRACKELGIKTVAVHSTADKNLKHVLLADESICIGKASATESY
LNIPRIIAAAEVTNSIAIHPGYGFLAENADFAEAVEKSGFIFIGPKAETINLMGDKVSAI
NAMKKAGVPCVPGSDGPLTDDVERNKAIAKRIGYPIIVKAAGGGGGRGMRVVRSEAELIK
AIETTQAEAGAAFGNSTVYMEKFLENPRHVEIQVLADGQGNAIHLGERDCSMQRRHQKVV
EEAPAPGISEQMRTKIGDRCRKACIEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVS
EMITGVDLIKEQLRIAAGQPLSIDQSQIQIRGHAIECRINAEDPQTFIPSPGPIDMFHAP
GGLGIRWESHIYAGYHVPPYYDSMIGKLITYGESRDEAIARMRHALEEIVVEGIKTNIPL
QRAIMADENFFAGGTNIHYLEKKLGLA