Protein Info for MIT1002_03937 in Alteromonas macleodii MIT1002

Annotation: Suppressor of F exclusion of phage T7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 71 to 99 (29 residues), see Phobius details PF04186: FxsA" amino acids 7 to 113 (107 residues), 128.2 bits, see alignment E=7.1e-42

Best Hits

KEGG orthology group: K07113, UPF0716 protein FxsA (inferred from 85% identity to amc:MADE_03920)

Predicted SEED Role

"FxsA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>MIT1002_03937 Suppressor of F exclusion of phage T7 (Alteromonas macleodii MIT1002)
MRVLFILFALLPILEIALLINVGSVIGGWNTVGLVLLSAFIGAYFVKREGVSTLQTAQEK
MQRNEVPGKELVEGLMLVVAGVLLVTPGFITDIFGFLLAMPGSRHFFAAQVSKHMKMRVV
APGMGPGTAGFGQGQSPFGQSPFDQRSRSHNSDGDVFEGEYTDHTTNDPDKRLK