Protein Info for MIT1002_03909 in Alteromonas macleodii MIT1002

Annotation: NAD(P) transhydrogenase subunit alpha part 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 138 to 154 (17 residues), see Phobius details amino acids 176 to 190 (15 residues), see Phobius details PF05222: AlaDh_PNT_N" amino acids 16 to 145 (130 residues), 124.5 bits, see alignment E=5.3e-40 PF01262: AlaDh_PNT_C" amino acids 150 to 375 (226 residues), 197.7 bits, see alignment E=2.6e-62

Best Hits

Swiss-Prot: 42% identical to PNTAA_RHORT: NAD(P) transhydrogenase subunit alpha part 1 (pntAA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 94% identity to amc:MADE_03898)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>MIT1002_03909 NAD(P) transhydrogenase subunit alpha part 1 (Alteromonas macleodii MIT1002)
MKIIILNESKAPDPLNNVEKRCAATPSSAQRLVKKGATLLLEAGAGVHSGYSDKEYKDVG
VTVIDDVNDALSTADMLVAVNKPTDAQLALMKKGAIVVGHLDPFFQQSLVESIAEKGLTA
ISVEMIPRSSRAQKMDALSSQASLAGYVMVMQAANQLPSILPMMMTPSGTIKPAKVFIIG
AGVAGLQAIATAKRLGANVLAYDTRPVVAEQVESLGGKFLKIDIGETGQTKDGYAKELTD
GQKAKQQEAQRDAIADSDIVITTAQLFGRKPPVLISKDTLALMKPGSVVVDMAATSGGNV
EGSVAGETVEVNGVKVIGNGYWSQYVAKAATDMYANNIYNLVDEFFDDETKTFGLNLEDD
ILAGCVITHDGSITNDMLNNAYKGA