Protein Info for MIT1002_03907 in Alteromonas macleodii MIT1002

Annotation: NAD(P) transhydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 52 (18 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details PF02233: PNTB" amino acids 9 to 457 (449 residues), 599.5 bits, see alignment E=2.5e-184

Best Hits

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 98% identity to amc:MADE_03896)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>MIT1002_03907 NAD(P) transhydrogenase subunit beta (Alteromonas macleodii MIT1002)
MSDIVTVINLAYVVAAALFILGLKLLSHPDTAKKGNFISAIGMLVAVVVTLLDQQIISYH
YILLGFVIGGAFGAWKAKTVEMTAMPEMVSLFNGFGGAASLLLGWATLAGMSLITLKTES
AFTFITLFFTILVGGITFSGSVVAWGKLSGKMSSKAVIFTGLRELSILHLIGMVVIGYFF
TTDPSNPLWIYCAIALSLSFGLWATISIGGADMPVVIALLNSYSGVAASAAGLATGNTIL
IVTGLLVGASGLILTNIMCKAMNRSLMNVLLSGFAKPVEAGEKIEGEIKVLSAQDAFYVL
EAAQAVLVVPGYGMAVAQAQHAVRELQSLLEENGCTVDYAIHAVAGRMPGHMNVLLAEAD
VPYDQLYEMDDVNPRMENYDVVIVIGANDVVNPAAKEMKGSPIYGMPVIEAHRAKTVFVL
KRSANAGFAGVDNPLFFKDNTRMVLGDAKDTINSIIREFGDD