Protein Info for MIT1002_03903 in Alteromonas macleodii MIT1002

Annotation: DNA-3-methyladenine glycosylase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF02805: Ada_Zn_binding" amino acids 25 to 86 (62 residues), 106 bits, see alignment E=1.6e-34 PF12833: HTH_18" amino acids 120 to 197 (78 residues), 58.2 bits, see alignment E=1.7e-19 PF06029: AlkA_N" amino acids 208 to 322 (115 residues), 99 bits, see alignment E=4.4e-32

Best Hits

KEGG orthology group: K13529, AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 78% identity to amc:MADE_03892)

Predicted SEED Role

"ADA regulatory protein" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>MIT1002_03903 DNA-3-methyladenine glycosylase 2 (Alteromonas macleodii MIT1002)
MPDNLFVSDMGASENSTTAESVLSKARLSRDPRFDGRFFVAVKTTGIFCRPICPARLPKE
ENVTYFQHATQAMAHGYRPCFRCRPDSAPRSAAWKGVGATINRALSLLSVIPIERVADIA
MRLGISERYLNKLVVNAVGIPPKQFQNMQRTLFAKQLIQQTHLSMTDIAITAGYQSLRQL
QRAIEQYCATSPTQLRKKEPVQQKAISLFLSYRPPYNWPYVRDFLATRAIEGMERVTNES
YERYFSCNESLGFFKAIHDEARHGFKLLIDMPELGRLHTIIENIKQVLDLHADPLLIEQS
LLQSGLPPSKLTPGLRLPSAWSVFESGCRAIVGQQVSVKAAIGQVTLLVHQLGETVSDAL
PSNGLESITSERYSFPSPESVAENSLEFLRMPQARKEAVRHFARLFINGNMPSHEDILAI
KGVGPWTLDYLKMRGERNPDIYLGGDLIVRKMAQQYPIAPEKAAPWRSYLTLQLWQLSNQ