Protein Info for MIT1002_03892 in Alteromonas macleodii MIT1002

Annotation: Bacteriophytochrome cph2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 186 to 351 (166 residues), 136.6 bits, see alignment E=3.2e-44 PF00990: GGDEF" amino acids 188 to 347 (160 residues), 141.3 bits, see alignment E=1.3e-45

Best Hits

KEGG orthology group: None (inferred from 84% identity to amc:MADE_03836)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>MIT1002_03892 Bacteriophytochrome cph2 (Alteromonas macleodii MIT1002)
MQINKPRELLRLRIALIIGAVLVLAFMAADLMLLPSSMYELYIFDRLLLQFPIILVVVVL
SFWRRFIQHRAYIFAGLLIALSYSNYWLIWVCWEEHSFIFPYEGTILYAFFCVFALGIAF
KLALAANVINILGFLGLMWVAPVYGDRVPISMAFVSGSLFICVYARYRLDRSVRMLKETN
DRLLKLSKFDPLSDLLNRRALREQSEKLLALSKRHKVSMAVMMLDLDDFKKYNDCFGHQQ
GDEAIKIQARIMKQVFKRETDILGRYGGEEFIVVLSDIQKEQVEKHCDALLNKWTEAALE
HAQDAKHPLMSCSIGVVFAKSAENMSIDCLIDEADKALYEAKEKGKAQFVLNQAQCLE