Protein Info for MIT1002_03868 in Alteromonas macleodii MIT1002

Annotation: Vibriobactin utilization protein ViuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF08021: FAD_binding_9" amino acids 11 to 117 (107 residues), 86.6 bits, see alignment E=1.6e-28 PF04954: SIP" amino acids 125 to 235 (111 residues), 107.3 bits, see alignment E=7.1e-35

Best Hits

KEGG orthology group: K07229, (no description) (inferred from 75% identity to amc:MADE_03816)

Predicted SEED Role

"Utilization protein for unknown catechol-siderophore X" in subsystem Iron acquisition in Vibrio

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>MIT1002_03868 Vibriobactin utilization protein ViuB (Alteromonas macleodii MIT1002)
MSKPQPRRAIVTQSVRITPNMQRVHLSGEDLLTFPSVTAGAYIKLMFDLEGNSLKRPTDT
NQVAMRTYTVAHFDTEKPEMVLDMVIHADGGKTGPASAWATSTKPGDIITLAGPGSSKGL
SEQYDWILLAGDMTALPSIRNHLAELPVQTKGYAVIKIEDEKDAVTLKKPEGVTVIWEHE
QSLPSRLDQLTWLDGNPTVWVACEFSDMRAIRTWLKDEKSVAHENIYISSYWKKGRSEDQ
HKIEKMQDSEAYAKTLA