Protein Info for MIT1002_03866 in Alteromonas macleodii MIT1002

Annotation: efflux transporter, putative, hydrophobe/amphiphile efflux-3 (HAE3) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 867 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 260 to 285 (26 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 336 to 349 (14 residues), see Phobius details amino acids 360 to 384 (25 residues), see Phobius details amino acids 429 to 447 (19 residues), see Phobius details amino acids 704 to 726 (23 residues), see Phobius details amino acids 732 to 753 (22 residues), see Phobius details amino acids 759 to 781 (23 residues), see Phobius details amino acids 808 to 828 (21 residues), see Phobius details amino acids 834 to 858 (25 residues), see Phobius details PF03176: MMPL" amino acids 157 to 391 (235 residues), 51.8 bits, see alignment E=6.1e-18 amino acids 642 to 863 (222 residues), 73.4 bits, see alignment E=1.7e-24 PF02460: Patched" amino acids 257 to 383 (127 residues), 28.7 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 72% identity to alt:ambt_20295)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (867 amino acids)

>MIT1002_03866 efflux transporter, putative, hydrophobe/amphiphile efflux-3 (HAE3) family (Alteromonas macleodii MIT1002)
MFTAVIERLLFLSTHKGKWIYAVLLLAVLFCAYQMRLITIDTDPENMLEANHPARVFHND
VKHTFAMHDAIVVGVIASSANDTATENADRTTNKGIYTPENLSAIDKVSQHILNTEGVIA
QDVMSFSTVDNITQGDSGELKFSWMMPNAPASQEEAGKIAEAIARLPMLQGTLASSSKNA
AAIYVPIKDKNESFRIAEDIRAFIGANTTNETLQWHITGLPVAEDQFGVEMFIQMAISAP
AAGLMIFILLFVFFRNFTLITAPMVVAMATVIITMGALIGLGFTVHIMSSMIAIFLMPIA
VVDSVHILSEFSDRYKPGQKADDVITTVVEHLFQPMLYTSLTSAAGFYSLMLTPIPPVQI
FGAFIGSGILLAFIITLTFIPAYISRMSPEALAKLQAALHTDANSSSVKATYLQRFVYGI
RNVALNYKGALLVAFMVISAVSVWGIFQIQINDNPVRWFKENHEIRVADKALNKEFAGTY
NAYIVIQDTRKLKSAGEILQSAVLPSSLDEWRKTTLDTLNNENAGNNYETLAFAVDDALF
GDLDSNEYDALNRLLSSIDEIKGTSKTFQQPDNVALLSDLQSYLSTQTLVGKTQSLSDVV
KVVNRELHSGNDSDYVLPNTQPAIAQTLLQYQSSHRPQDLWHFVTPDYRKTLVWLQLSSG
DNQDMTEVIELVDNYFAQHPLPDGLTYQWAGKAYLNVVWQDNMVAGMLDSLLSAFIIVFV
MMVLLLRSLVFGLLAMLPLTITITFIYGAIGIVGKDYDMPIAVLSALTLGLSVDFAIHFL
ARAKEIYKQTGDVNATLSAMFEEPASAITRNALVIALGFTPLLLAPLVPYITVGIFLASI
MFISALVTLLVLPAAMTLLKRWVFKEA