Protein Info for MIT1002_03854 in Alteromonas macleodii MIT1002

Annotation: Sulfite exporter TauE/SafE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 16 to 64 (49 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 193 to 195 (3 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details PF01925: TauE" amino acids 23 to 247 (225 residues), 66.1 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: None (inferred from 92% identity to amc:MADE_03809)

Predicted SEED Role

"Bll7429 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>MIT1002_03854 Sulfite exporter TauE/SafE (Alteromonas macleodii MIT1002)
MELLYSWLTANDAMSMSSSVVLVVTSFFTSMMTATLGIGGGVLLLAVMAGTMPVSALIPV
HGLVQLGSNGNRALMTARHIDWNMLKYFSLGAIVGAFLASFVVVQLPLVIIQFAVAAFIL
FLVWGSKPKAQEMNPAGRTLAGLVTTLVSMFVGATGPLVAAFVHRNNYSKMQITGTFASC
MTLQHGLKAFVFTFVGFSFAQWAGLIIIMIASGALGTFIGLKVLKRVPAEKFMLAFKIVV
TLLALRLLWQAFSTLFPAVI