Protein Info for MIT1002_03845 in Alteromonas macleodii MIT1002

Annotation: Multidrug resistance ABC transporter ATP-binding and permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 56 (28 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 333 to 468 (136 residues), 72.4 bits, see alignment E=2.9e-24

Best Hits

Predicted SEED Role

"Transport ATP-binding protein CydC" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>MIT1002_03845 Multidrug resistance ABC transporter ATP-binding and permease protein (Alteromonas macleodii MIT1002)
MKSKPAYLTLLLALLHGMAGITILVISSWFIAISAIAPVGFNYVIPAVVIRALALLRIAS
GYASMWVGHNDLLARIAGGRLRVFRQLENSKITDKAFTTEALAQHTEELASRWIAWIAPL
SNITFIFTNLCVVAVWFNLPGTSFLITLFAIWLFIVVLQGFIGLNVAEKATKENKVFRQE
SADFLNCSALWHLNKTMTDKPQEEGGHVINSVPSADRVWRQQTTQKDKAQRASWWFQGAA
FFAVVLVMSGAVSPISDFSYMPIAIVVPMILMAAPDWAGAAFHSITKFAQHKQSAKALKK
LKTSPIKVLERTELHHSLTLSDYTAKNRRLPLVNATFPATGIVCISGPSGCGKSSLLQSI
AGVVPSTGLKEVDGMRIADGLIKNWRYVEQEPIVLSGSVSSNLDPAGMGIPLDDMTNLLA
QLGLEALLPLSMWVGKAGRTLSGGERKRLALARAILSHAKVLLVDEPFEGLDVTTQHKVC
EVLNRYAANHLILVASHVTPSALNVSSTLLLEEARMDNLCAGQHAIWLP