Protein Info for MIT1002_03839 in Alteromonas macleodii MIT1002

Annotation: Malate-2H(+)/Na(+)-lactate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 111 to 137 (27 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details amino acids 440 to 463 (24 residues), see Phobius details TIGR00931: Na+/H+ antiporter NhaC" amino acids 9 to 464 (456 residues), 414.1 bits, see alignment E=3.5e-128 PF03553: Na_H_antiporter" amino acids 25 to 174 (150 residues), 24.7 bits, see alignment E=6.8e-10 amino acids 162 to 463 (302 residues), 177.1 bits, see alignment E=2.6e-56

Best Hits

KEGG orthology group: K03315, Na+:H+ antiporter, NhaC family (inferred from 94% identity to amc:MADE_03793)

Predicted SEED Role

"Na+/H+ antiporter NhaC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>MIT1002_03839 Malate-2H(+)/Na(+)-lactate antiporter (Alteromonas macleodii MIT1002)
MTDEQRATPSLLLALTPVVLTLLILGTQIFYFGVFEPHIPLAIGIALTSFVGTYLGLTWE
EVRAGIFKVIHVALPSVSVLIVVGMIIGIWIASGTVPTIIYYGLKTLSPQIFLAAGMVIC
AVVSVSLGTSWGSVGTVGLALMGIGEGFDIPKYWTAGAVVSGAFFGDKVSPLSDTTNLAP
AVTGTDVFSHIKNMMATTIPAMVLAFLIYLGVGFFVIDAQSVSFAKIAGITSALEDNFTV
TGWALLPALVVMGLALKKIPPLPALFAGAVVGGAFAMFMQGQSLQAVFDYANNGYAIQTN
IVEIDSLLNRGGVQSMMWTISLVLIALGFGGALETTGCLRSIINAIKSKAKTFAGTQIAA
VGTAFSTNLVAGDPYLSVALPGRMYSPVYRGMGYSTLNLSRGIEEGGTLMSPLIPWNAGG
AFVISALGLGISGANLENLLYIPLAFACWTAPLIGIFYAYVGWFSPKATKAEKEEWESSG
AEIAKFNKDGTPVTE