Protein Info for MIT1002_03835 in Alteromonas macleodii MIT1002

Annotation: Cadmium, cobalt and zinc/H(+)-K(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 37 to 305 (269 residues), 189.7 bits, see alignment E=3.4e-60 PF01545: Cation_efflux" amino acids 40 to 224 (185 residues), 139.5 bits, see alignment E=1.2e-44 PF16916: ZT_dimer" amino acids 232 to 302 (71 residues), 30.3 bits, see alignment E=3.4e-11

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 84% identity to amc:MADE_03787)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>MIT1002_03835 Cadmium, cobalt and zinc/H(+)-K(+) antiporter (Alteromonas macleodii MIT1002)
MHHHNHSTTASNHHKGQHHGHHHGAHAEALGTDSTRIGWAFWLNFIFTIIEFIGGWLTNS
VAIMADAVHDLGDSLSIGLAWYLSKLGNKASTEKYTYGFKRLSLMGAMINGVILVIGSIW
VLSEAIPRLSNPEMPVTEGMIGLAILGIVVNGFAAYKLHGGHSMNEKVLNWHLIEDTMGW
VAVLVVAIVLHFVEWPILDPILSIGFTLFILVNVVRYVVQTMSLFLQGVPDLATRNAISN
TLLKIEHVEEIHHVHFWSLDGEQHVLTAHVVINCAIDNDKLRALKKEVHERLAPFELAHT
TIEFELPGEPCRDDNDHLHAHSHEHQHEEIN