Protein Info for MIT1002_03833 in Alteromonas macleodii MIT1002

Annotation: putative symporter YidK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 120 to 144 (25 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details amino acids 331 to 359 (29 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 407 to 429 (23 residues), see Phobius details amino acids 436 to 456 (21 residues), see Phobius details amino acids 462 to 484 (23 residues), see Phobius details amino acids 505 to 524 (20 residues), see Phobius details amino acids 536 to 559 (24 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 35 to 443 (409 residues), 282.4 bits, see alignment E=3.5e-88 PF00474: SSF" amino acids 35 to 438 (404 residues), 169.8 bits, see alignment E=4.7e-54

Best Hits

Swiss-Prot: 46% identical to YIDK_ECOLI: Uncharacterized symporter YidK (yidK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to alt:ambt_20120)

Predicted SEED Role

"Similarity to Na+/myo-inositol cotransporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>MIT1002_03833 putative symporter YidK (Alteromonas macleodii MIT1002)
MDITLTLLSCMAFMALVAVISYMKTKGEVNTQDGYFLAGRGLTGTFIAGSMILTNLSAEQ
LIGLNGSAFGYNLSAMAWEVTAGISTIIMALIFLPRYLAGAFSTLPEFLRDRFDDSVRRM
TVVLFMVGYSLVTIPSVLYSGSIAVLRLFDVPGLFNVSYEVGLVLTIVIVGTIGALYAIF
GGLKAVAVSDTINGVGLLIVGLLVPVLGLVALGDGSFSQGLSTIATTETEKLNAIGGPDD
PVPFGTIFTGMILANLFYWGTNQYVIQRTLGAKNLVEGQKGVLFSGYFKVLVPFMMMLPG
VIAYHLYQDENLQTIDLAYPHLVKDVLPQYLSGFFLAVLLGAVFSSFNSLLNSAATLFCL
DVYKPFKKDKVSDEKLIRVAKITSIVIAVLSFITAPLLMFAPEGLWQIIRIFTGFYNIPV
ITIVLVGLFTKRVPALAAKVAIIFHVIAYGLLKFVWEVDINFIHIYAILFAIELAIMLTI
GRLYPMTTPWHFTAKAEVNMTPWRYAIPCAIVLVGLIATLYLMFSPVGFVNGLSNAFVPA
LVGLWATCFVAIGISLKWWRVKYEQGLKRLASQHA