Protein Info for MIT1002_03829 in Alteromonas macleodii MIT1002

Annotation: putative oxidoreductase/MSMEI_2347

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00248: Aldo_ket_red" amino acids 12 to 293 (282 residues), 155.9 bits, see alignment E=6.3e-50

Best Hits

Swiss-Prot: 52% identical to XYL1_KLULA: NAD(P)H-dependent D-xylose reductase (XYL1) from Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

KEGG orthology group: None (inferred from 87% identity to alt:ambt_20095)

MetaCyc: 51% identical to NADH-dependent D-xylose reductase monomer (Candida parapsilosis)
RXN-22818 [EC: 1.1.1.430]

Predicted SEED Role

"NADPH-dependent aldo-keto reductase, similarity to GRE3, stress-induced in yeast"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.430

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>MIT1002_03829 putative oxidoreductase/MSMEI_2347 (Alteromonas macleodii MIT1002)
MNKIPEVGFGFWKVDTAICAETTYQAIKAGYRHLDCAADYGNEKEVGEGIKRAIDEGLCT
REELWVTSKLWNTFHAPEHVGLALEKTLSDLQLDYVDLYLIHFPIAQKFVPIETRYPPEW
FYEPDAAEPKMELAPVPLHKTWEAMESLADSGKAKQIGVCNYNTGLLNDLMSYARIKPAM
LQIESHPYLTQERLIRLAKDYGLEVTAFSPLGALSYLELEMADQTESVLEQSVVKAAAEA
HGKTPAQVVLRWGIQRGNAIIPKTSKVERMKENLALFDFSLSDSEMQAISALNVNRRFND
PGRFCEAAFNRFHPIYD