Protein Info for MIT1002_03827 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 310 to 333 (24 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 14 to 315 (302 residues), 219.1 bits, see alignment E=3.5e-69

Best Hits

Swiss-Prot: 48% identical to Y845_CHLTE: UPF0324 membrane protein CT0845 (CT0845) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: None (inferred from 82% identity to alt:ambt_20085)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>MIT1002_03827 hypothetical protein (Alteromonas macleodii MIT1002)
MNDIAVKCKNIWPGLGIATITGMAALFLSEHYNAPAMLFALLLGMAVSFLHQNDTPCACG
IDFTASTLLRAGVVLLGLRIALGDLAVLGWQTALMLAAAILTTIIVGVGLAKLLGLQKRF
GALTGGSVAICGASAALAISTILPKGENHERDTLLTVIGVTAMSTIAMVLYPIVAAQLGM
NDTEAGIFLGGTIHDVAQVVGAGYSVSDSAGDMATLTKLVRVAMLMPVVLIMMIAIKHFY
KAKSQADGAQVPKMPMFLVGFIVLMLLNSFVTLPEVVIETGTQISRFFLVVSITAIGMKS
NLGKLAEVGMLPIVMIVAETLWIALLILGYLFAI