Protein Info for MIT1002_03794 in Alteromonas macleodii MIT1002

Annotation: Epoxyqueuosine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00276: epoxyqueuosine reductase
  • amino acids 16 to 351 (336 residues), 513.7 bits, E=9.9e-159
• PF08331: QueG_DUF1730
  • amino acids 64 to 142 (79 residues), 89.6 bits, E=1e-29
• PF13484: Fer4_16
  • amino acids 195 to 258 (64 residues), 81.5 bits, E=6.1e-27

Best Hits

Swiss-Prot: 64% identical to QUEG_ECOLI: Epoxyqueuosine reductase (queG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to amc:MADE_00643)

MetaCyc: 64% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

MetaCyc Pathways

• queuosine biosynthesis I (de novo) (4/4 steps found)
• queuosine biosynthesis III (queuosine salvage) (3/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Protein Sequence (380 amino acids)

>MIT1002_03794 Epoxyqueuosine reductase (Alteromonas macleodii MIT1002)
MSEFSSIDLVELTNNIKAWGTALGFQQVGISDIDLHQHEAHLQEWLDNGYHGDMAFMESH
GMKRARPDELVPGTLRVISVRMNYLPPDASFAKHLKKPEIGYISRYALGRDYHKVLRKRL
KQLGEKITASLAHTQYRPFVDSAPVLEHAIAEKAGIGWTGKHSLTLNKEAGSWFFLGELF
INLPLPTDSPIEEGCGTCTACLTICPTNAIVAPYKVDARRCISYLTIESDKDIPEDLRPM
MGNRIYGCDDCQLVCPWNRFADVTSEEDFHPRQVLHGQSLNALFGWSEETFLRNTEGSPI
RRIGFEKWQRNIAVALGNAPYDEQSILLLKERRGSVSDLVDRHIDWALKRQQEKQQASDA
KNRQQARLIRVIEKGLPRDA