Protein Info for MIT1002_03790 in Alteromonas macleodii MIT1002

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 309 (309 residues), 329.5 bits, see alignment E=1.4e-102 PF02518: HATPase_c" amino acids 21 to 77 (57 residues), 32.9 bits, see alignment 1.1e-11 PF13589: HATPase_c_3" amino acids 24 to 117 (94 residues), 55.2 bits, see alignment E=1.2e-18 PF01119: DNA_mis_repair" amino acids 212 to 328 (117 residues), 116.1 bits, see alignment E=1.1e-37

Best Hits

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (619 amino acids)

>MIT1002_03790 DNA mismatch repair protein MutL (Alteromonas macleodii MIT1002)
MPIQLLSPQLANQIAAGEVVERPASVVKELLENSLDAGATKIEVDIEKGGHKRIRIKDNG
SGIVKSELQLALSRHATSKITTLDDLEQILSLGFRGEALASISSVSRLTLTSRTESQGEA
WQAYCEGREMAVNIQPAAHPVGTTIDVADLFYNTPARRKFLRTEKTEFQHIEEVIKRIAL
SYPKVSFVLKHNDKVAKRFIADKAGSLATRIGAVVGQKFVQNAVHISTEYEGLHIDAWLG
NEAMLRSSNDCQFSFVNGRGMRDKLIMHAIRQAYESVWGVLEQPSFVVYLTVNPKDVDVN
VHPAKHEVRFQQGRLVHDFICKTVSDALHAMTDEQPLSGMDANRPSGSDFMSSQVEHDYI
RPLQNQTSDNAQAFNESSRYSTGGVSQGAPQPYGQFTGSPRNTSSGSASGGRSGGATHKQ
SRGPSAAYQSNYNALMTPNSDIINNNADPIAGVEHVNLTSQCRIYPKSEKIYLLCATKVA
SIWLSELFLKAQHGQPLLMPVAVSLNNVNEQLVTLLNDAHFEVNKVAGKYRLQQVPAGTR
HLPWLKWFEYFLLVELNDEVNSLDDAVKSLVLPEHVLDEETSNALWYWLDQQSEVKQWEI
IEQFAKVRPLNSVLDVWGE