Protein Info for MIT1002_03777 in Alteromonas macleodii MIT1002

Annotation: 3-demethylubiquinone-9 3-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 17 to 243 (227 residues), 256.1 bits, E=1.2e-80
• PF02353: CMAS
  • amino acids 26 to 190 (165 residues), 30.5 bits, E=1.1e-10
• PF13489: Methyltransf_23
  • amino acids 65 to 175 (111 residues), 66.3 bits, E=1.2e-21
• PF13847: Methyltransf_31
  • amino acids 67 to 171 (105 residues), 61.4 bits, E=4e-20
• PF01209: Ubie_methyltran
  • amino acids 68 to 173 (106 residues), 24.3 bits, E=8.6e-09
• PF05175: MTS
  • amino acids 69 to 168 (100 residues), 30.9 bits, E=8.7e-11
• PF06325: PrmA
  • amino acids 70 to 170 (101 residues), 38.8 bits, E=3.6e-13
• PF13649: Methyltransf_25
  • amino acids 71 to 163 (93 residues), 67.1 bits, E=8.5e-22
• PF08242: Methyltransf_12
  • amino acids 72 to 165 (94 residues), 59.1 bits, E=2.8e-19
• PF08241: Methyltransf_11
  • amino acids 72 to 167 (96 residues), 73 bits, E=1.1e-23

Best Hits

Swiss-Prot: 43% identical to UBIG_PARL1: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 82% identity to amc:MADE_00659)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.64

Protein Sequence (250 amino acids)

>MIT1002_03777 3-demethylubiquinone-9 3-methyltransferase (Alteromonas macleodii MIT1002)
MLDKSKKTGDSNFSEQEIARFDALADSWWDPEGKYKTALDFNRARLNVIKAQIENHFGQG
NLPPDYSALSVIDIGSGGGLISEPLAKLGAQVTGIDASAVSVEVAKRHAQNTGVKVDYQH
KLSSEVVEEGRQYDVVINAEVVEHVPDQQQLMRECASLVKPGGLLILATLNRTLKSYVVA
IVGAEYVMRYLPIGTHDWKKFVKPSELKRWIGNEFTLKYQVGMRLNPLKGEWLTSSSLAV
NYIQAYSKHK