Protein Info for MIT1002_03777 in Alteromonas macleodii MIT1002

Annotation: 3-demethylubiquinone-9 3-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 17 to 243 (227 residues), 256.1 bits, see alignment E=1.2e-80 PF02353: CMAS" amino acids 26 to 190 (165 residues), 30.5 bits, see alignment E=1.1e-10 PF13489: Methyltransf_23" amino acids 65 to 175 (111 residues), 66.3 bits, see alignment E=1.2e-21 PF13847: Methyltransf_31" amino acids 67 to 171 (105 residues), 61.4 bits, see alignment E=4e-20 PF01209: Ubie_methyltran" amino acids 68 to 173 (106 residues), 24.3 bits, see alignment E=8.6e-09 PF05175: MTS" amino acids 69 to 168 (100 residues), 30.9 bits, see alignment E=8.7e-11 PF06325: PrmA" amino acids 70 to 170 (101 residues), 38.8 bits, see alignment E=3.6e-13 PF13649: Methyltransf_25" amino acids 71 to 163 (93 residues), 67.1 bits, see alignment E=8.5e-22 PF08241: Methyltransf_11" amino acids 72 to 167 (96 residues), 73 bits, see alignment E=1.1e-23 PF08242: Methyltransf_12" amino acids 72 to 165 (94 residues), 59.1 bits, see alignment E=2.8e-19

Best Hits

Swiss-Prot: 43% identical to UBIG_PARL1: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 82% identity to amc:MADE_00659)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>MIT1002_03777 3-demethylubiquinone-9 3-methyltransferase (Alteromonas macleodii MIT1002)
MLDKSKKTGDSNFSEQEIARFDALADSWWDPEGKYKTALDFNRARLNVIKAQIENHFGQG
NLPPDYSALSVIDIGSGGGLISEPLAKLGAQVTGIDASAVSVEVAKRHAQNTGVKVDYQH
KLSSEVVEEGRQYDVVINAEVVEHVPDQQQLMRECASLVKPGGLLILATLNRTLKSYVVA
IVGAEYVMRYLPIGTHDWKKFVKPSELKRWIGNEFTLKYQVGMRLNPLKGEWLTSSSLAV
NYIQAYSKHK