Protein Info for MIT1002_03765 in Alteromonas macleodii MIT1002

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 93 to 125 (33 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 191 to 220 (30 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details PF04235: DUF418" amino acids 219 to 373 (155 residues), 78.3 bits, see alignment E=3.5e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>MIT1002_03765 putative membrane protein (Alteromonas macleodii MIT1002)
MRIHSIDAVRGLAILGILFMNITFHQNGYANYAFFEEPLLSDTVISLFNTLFLDGRFRSL
FCLLFGAGLAIQFEACEKRGHHFLDFSQARLKWLFVFGLLHGVFIFSGDILLYYSLCALF
ILKHFMLPQDELKKKSIHYLIVGSAIMLVGGLIMAFVFDMGAELPTRPSETFNEEAALWQ
SGYLTQLGIQASFMLSTVIIAPFTMLWQSMGLMMFGAYLYRAGFFNHGFSSLLFKKLVLV
AIVTSIITALPQFLFEQVTLDVIPMFTSIPAIFCALVYAHLLINIRHTAAWWYQSLINCG
KVAFTLYLTQSIALAVLFRIVMPAYFPNFIYSVTLLDLLLVTIAFTAVQVILANAITKHF
NQGPFEALWRKMYLRSFHKKQKLKHDEVEQLT